PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G77920.1
Common NameBZIP50, F28K19.13, TGA7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 368aa    MW: 41913.1 Da    PI: 6.3808
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G77920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.62e-1192134446
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                  +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L 
  AT1G77920.1  92 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELE 134
                  6899**************************8888887776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-884161IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-990135No hitNo description
PROSITE profilePS502179.40491135IPR004827Basic-leucine zipper domain
PfamPF001705.9E-892134IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.37E-693133No hitNo description
PROSITE patternPS00036096111IPR004827Basic-leucine zipper domain
PfamPF141442.6E-30170244IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0005516Molecular Functioncalmodulin binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MMSSSSPTQL ASLRDMGIYE PFQQIVGWGN VFKSDINDHS PNTATSSIIQ VDPRIDDHNN  60
NIKINYDSSH NQIEAEQPSS NDNQDDDGRI HDKMKRRLAQ NREAARKSRL RKKAYVQQLE  120
ESRLKLSQLE QELEKVKQQG HLGPSGSINT GIASFEMEYS HWLQEQSRRV SELRTALQSH  180
ISDIELKMLV ESCLNHYANL FQMKSDAAKA DVFYLISGMW RTSTERFFQW IGGFRPSELL  240
NVVMPYLQPL TDQQILEVRN LQQSSQQAED ALSQGIDKLQ QSLAESIVID AVIESTHYPT  300
HMAAAIENLQ ALEGFVNQAD HLRQQTLQQM AKILTTRQSA RGLLALGEYL HRLRALSSLW  360
AARPQEPT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.165220.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453376920.0
Genevisible262137_at0.0
Expression AtlasAT1G77920-
AtGenExpressAT1G77920-
ATTED-IIAT1G77920-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G77920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q93ZE2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G77920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3157360.0AJ315736.1 Arabidopsis thaliana mRNA for AtbZIP50 protein.
GenBankAK2288610.0AK228861.1 Arabidopsis thaliana mRNA for bZip transcription factor AtbZip50, complete cds, clone: RAFL16-18-O03.
GenBankAY0575960.0AY057596.1 Arabidopsis thaliana At1g77920/F28K19_13 mRNA, complete cds.
GenBankBT0101640.0BT010164.1 Arabidopsis thaliana At1g77920/F28K19_13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565162.10.0transcription factor TGA7
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLQ0WQ440.0Q0WQ44_ARATH; BZip transcription factor AtbZip50
STRINGAT1G77920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Representative plantOGRP26791132
Publications ? help Back to Top
  1. Després C,DeLong C,Glaze S,Liu E,Fobert PR
    The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors.
    Plant Cell, 2000. 12(2): p. 279-90
    [PMID:10662863]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Reddy VS,Ali GS,Reddy AS
    Genes encoding calmodulin-binding proteins in the Arabidopsis genome.
    J. Biol. Chem., 2002. 277(12): p. 9840-52
    [PMID:11782485]
  4. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  5. Ma L, et al.
    Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis.
    Plant Cell, 2002. 14(10): p. 2383-98
    [PMID:12368493]
  6. Després C, et al.
    The Arabidopsis NPR1 disease resistance protein is a novel cofactor that confers redox regulation of DNA binding activity to the basic domain/leucine zipper transcription factor TGA1.
    Plant Cell, 2003. 15(9): p. 2181-91
    [PMID:12953119]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  9. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  10. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  11. Liu G,Holub EB,Alonso JM,Ecker JR,Fobert PR
    An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance.
    Plant J., 2005. 41(2): p. 304-18
    [PMID:15634206]
  12. Hepworth SR,Zhang Y,McKim S,Li X,Haughn GW
    BLADE-ON-PETIOLE-dependent signaling controls leaf and floral patterning in Arabidopsis.
    Plant Cell, 2005. 17(5): p. 1434-48
    [PMID:15805484]
  13. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  14. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  15. Kesarwani M,Yoo J,Dong X
    Genetic interactions of TGA transcription factors in the regulation of pathogenesis-related genes and disease resistance in Arabidopsis.
    Plant Physiol., 2007. 144(1): p. 336-46
    [PMID:17369431]
  16. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  17. Li S, et al.
    Nuclear activity of ROXY1, a glutaredoxin interacting with TGA factors, is required for petal development in Arabidopsis thaliana.
    Plant Cell, 2009. 21(2): p. 429-41
    [PMID:19218396]
  18. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]